PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG027221.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NZZ/SPL
Protein Properties Length: 321aa    MW: 34981.3 Da    PI: 8.7776
Description NZZ/SPL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG027221.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NOZZLE215.4e-0731773683
       NOZZLE 36 rtetkksrgrkpgsktaqqkqkkptlrgmgvaklerfiieeekkklvv 83
                    t  +r rkp ++ +q ++k+p  rgmgva+le  +i+e  k ++ 
  CCG027221.1 31 TRTTTTTRTRKPTANKCQTRKKQPR-RGMGVAQLENLRIQERWKAITE 77
                 3336789**********99999995.*************998876633 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF087448.0E-53176IPR014855Plant transcription factor NOZZLE
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MATSLSLFLM PSDDRKQEST LAISTKPAEP TRTTTTTRTR KPTANKCQTR KKQPRRGMGV  60
AQLENLRIQE RWKAITETNQ IGSLNLQPTK QMHVFDPFNN NDDDNQMAQS GTTVNHGVPM  120
RNNGVVFNGF LGWDHQGGVV VKRVDEFNAN NNGGFGCQVL VNPYMVGSAP VHQAGAPAPA  180
PAAAAVLEAS KELSSIPKVM QQQKQHEPAR CDLCFKMGGF SARAATSAFY AKYQNHNNNE  240
GVEAMEAHRK GSNAMGRKVI MEYELFPGKN SKSTCFKDME FPTAEASVAV GTGEASCVTT  300
YSDYSASDAS NSIDLSLKLS Y
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011002471.10.0PREDICTED: uncharacterized protein LOC105109446
RefseqXP_011016722.10.0PREDICTED: uncharacterized protein LOC105120239
TrEMBLB9N5610.0B9N561_POPTR; Uncharacterized protein
STRINGPOPTR_0001s41950.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83651723